CDS

Accession Number TCMCG023C25279
gbkey CDS
Protein Id PIN01949.1
Location join(160..310,596..621)
Organism Handroanthus impetiginosus
locus_tag CDL12_25536

Protein

Length 58aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA324125, BioSample:SAMN05195323
db_source NKXS01006152.1
Definition hypothetical protein CDL12_25536 [Handroanthus impetiginosus]
Locus_tag CDL12_25536

EGGNOG-MAPPER Annotation

COG_category C
Description Belongs to the mitochondrial carrier (TC 2.A.29) family
KEGG_TC 2.A.29
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko02000        [VIEW IN KEGG]
KEGG_ko ko:K15121        [VIEW IN KEGG]
EC -
KEGG_Pathway -
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0005215        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005739        [VIEW IN EMBL-EBI]
GO:0005740        [VIEW IN EMBL-EBI]
GO:0005741        [VIEW IN EMBL-EBI]
GO:0005743        [VIEW IN EMBL-EBI]
GO:0006810        [VIEW IN EMBL-EBI]
GO:0006839        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0016021        [VIEW IN EMBL-EBI]
GO:0019866        [VIEW IN EMBL-EBI]
GO:0019867        [VIEW IN EMBL-EBI]
GO:0022857        [VIEW IN EMBL-EBI]
GO:0031090        [VIEW IN EMBL-EBI]
GO:0031224        [VIEW IN EMBL-EBI]
GO:0031300        [VIEW IN EMBL-EBI]
GO:0031301        [VIEW IN EMBL-EBI]
GO:0031306        [VIEW IN EMBL-EBI]
GO:0031307        [VIEW IN EMBL-EBI]
GO:0031966        [VIEW IN EMBL-EBI]
GO:0031967        [VIEW IN EMBL-EBI]
GO:0031968        [VIEW IN EMBL-EBI]
GO:0031975        [VIEW IN EMBL-EBI]
GO:0032592        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044425        [VIEW IN EMBL-EBI]
GO:0044429        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044455        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0051179        [VIEW IN EMBL-EBI]
GO:0051234        [VIEW IN EMBL-EBI]
GO:0055085        [VIEW IN EMBL-EBI]
GO:0098573        [VIEW IN EMBL-EBI]
GO:0098588        [VIEW IN EMBL-EBI]
GO:0098805        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGGGCATGAAACAAAACCCACAGCCAGACAAGTAGTTAAGAAATTGATAGCTGATGATGGATGGACTGGATTTTATAGAGGTCTTGGCCCAAGATTTTTCAGCATGTCAGCTTGGGGAACCTCGATGATTCTTGCCTATGAATATCTAAAGCGCTTGTGTGCAAAAGATGAATAG
Protein:  
MGHETKPTARQVVKKLIADDGWTGFYRGLGPRFFSMSAWGTSMILAYEYLKRLCAKDE